Produkte > OMRON > Alle Produkte des Herstellers OMRON (26888) > Seite 410 nach 449

Wählen Sie Seite:    << Vorherige Seite ]  1 44 88 132 176 220 264 308 352 396 405 406 407 408 409 410 411 412 413 414 415 440 449  Nächste Seite >> ]
Foto Bezeichnung Hersteller Beschreibung Verfügbarkeit Privatkunde
E6C3-AG5B 256P/R 1M E6C3-AG5B 256P/R 1M OMRON e6c3-a_ds_e_8_1_csm494.pdf Category: Encoders
Description: Encoder: absolute; Usup: 12÷24VDC; 256imp/revol; OUT: PNP; IP65
Operating temperature: -10...70°C
IP rating: IP65
Output configuration: PNP
Sensors features: shaft 8mm
Body dimensions: Ø50x58mm
Lead length: 1m
Supply voltage: 12...24V DC
Resolution: 256imp/revol.
Type of encoder: absolute
Connection: cables
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-AG5B 256P/R 2M E6C3-AG5B 256P/R 2M OMRON e6c3-a_ds_e_8_1_csm494.pdf Category: Encoders
Description: Encoder: absolute; Usup: 12÷24VDC; 256imp/revol; OUT: PNP; IP65
Operating temperature: -10...70°C
IP rating: IP65
Output configuration: PNP
Sensors features: shaft 8mm
Body dimensions: Ø50x58mm
Lead length: 2m
Supply voltage: 12...24V DC
Resolution: 256imp/revol.
Type of encoder: absolute
Connection: cables
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
AX-RC00252981-DE OMRON Category: Three Phase Inverters
Description: DC link reactor; 298.1A; 0.25mH
Type of control accessories: DC link reactor
Current rating: 298.1A
Inductance: 0.25mH
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G3NA-490B-UTU-2 5-24VDC G3NA-490B-UTU-2 5-24VDC OMRON Category: One Phase Solid State Relays
Description: Relay: solid state; 90A; 1-phase
Type of relay: solid state
Relay variant: 1-phase
Max. operating current: 90A
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G3NA-490B-UTU-2 100-240VAC G3NA-490B-UTU-2 100-240VAC OMRON Category: One Phase Solid State Relays
Description: Relay: solid state; 90A; 1-phase
Type of relay: solid state
Max. operating current: 90A
Relay variant: 1-phase
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
XS4W-D521-105-D OMRON Category: I/O Systems and Modules
Description: Connection cable; IP67; 5m; Type: straight; PIN: 5; DRT2
Type of control accessories: connection cable
IP rating: IP67
Cable length: 5m
Connector variant: straight
Number of pins: 5
Application - series/manufacturer: DRT2
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
A22NS-3BM-NBA-G121-NN OMRON Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 3; NC + NO x2; black; none; IP66
Manufacturer series: A22NS
Type of switch: rotary
Illumination: none
Operating temperature: -25...70°C
Switch standard: 22mm
Mounting hole dimensions: Ø22.3mm
Stable positions number: 3
Number of positions: 3
Contacts configuration: NC + NO x2
IP rating: IP66
Leads: screw terminals
Actuator colour: black
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
XS3F-M8PVC4S5M XS3F-M8PVC4S5M OMRON XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M8 female; straight; Len: 5m
Type of connection cable: for sensors/automation
Number of pins: 4
Cable/adapter structure: M8 female
Connector variant: straight
Cable length: 5m
Connector: plug
Max. operating voltage: 125V DC
Max. operating current: 1A
Manufacturer series: XS3
Wire insulation material: PVC
IP rating: IP67
Insulation colour: black
Cable external diameter: 5mm
Polarisation: A code - DeviceNet / CANopen
Operating temperature: -10...80°C
auf Bestellung 14 Stücke:
Lieferzeit 14-21 Tag (e)
4+28.1 EUR
10+23.82 EUR
Mindestbestellmenge: 4 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D2SP0242C OMRON Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
auf Bestellung 131 Stücke:
Lieferzeit 14-21 Tag (e)
53+2.49 EUR
Mindestbestellmenge: 53 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D2SP0246F OMRON Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
auf Bestellung 148 Stücke:
Lieferzeit 14-21 Tag (e)
24+5.41 EUR
120+4.87 EUR
Mindestbestellmenge: 24 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D2SP0256C OMRON Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
auf Bestellung 140 Stücke:
Lieferzeit 14-21 Tag (e)
24+5.47 EUR
120+4.94 EUR
Mindestbestellmenge: 24 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D4BS-45FS D4BS-45FS OMRON c094_d4bs_safety-door_switch_datasheet_en.pdf Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4BS-25FS D4BS-25FS OMRON c094_d4bs_safety-door_switch_datasheet_en.pdf Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: G1/2
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4BS-4AFS D4BS-4AFS OMRON C094-E2-04A-X%2BD4BS%2BDatasheet.pdf Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC x2; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC x2
Safety switches features: no key
Switches features: slow action contacts
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D40ML-SS2-B-ACT D40ML-SS2-B-ACT OMRON Category: Standard Safety Switches
Description: Actuator; IP67; stainless steel; -25÷40°C; 600N; D40ML
Force: 600N
Application - series/manufacturer: D40ML
IP rating: IP67
Operating temperature: -25...40°C
Type of sensors accessories: actuator
Body material: stainless steel
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
FQ2-S30010F-08 FQ2-S30010F-08 OMRON fq2_q193-e1_14_6_csm1006918.pdf?id=3131 Category: Measurement Sensors
Description: Sensor: vision; 57mm; NPN; FQ2-S3; Resolution: 760000px
Type of sensor: vision
Range: 57mm
Output configuration: NPN
Manufacturer series: FQ2-S3
Resolution: 760000px
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G3NA-250B-UTU 5-24VDC G3NA-250B-UTU 5-24VDC OMRON Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 5÷24VDC; 50A; 24÷240VAC; G3NA; 1-phase
Manufacturer series: G3NA
Body dimensions: 58x43x27mm
Type of relay: solid state
Operating temperature: -30...80°C
Max. operating current: 50A
Switched voltage: 24...240V AC
Control voltage: 5...24V DC
Relay variant: 1-phase
Related items: R99-12
Switching method: zero voltage switching
Caution!: Maximal load current with use of suitable heatsink
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
1+149.67 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X8MC312-M1 E2E-X8MC312-M1 OMRON E2A-replacement.pdf E2E-NEXT-small-EN.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; IP67
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 48mm
Max. operating current: 0.1A
Number of pins: 4
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: M12 male
Manufacturer series: E2E Next
Trade name: E2E Next
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X5MC312 2M E2E-X5MC312 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷5mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...5mm
Overall length: 47mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X8MC312 2M E2E-X8MC312 2M OMRON E2A-replacement.pdf E2E-NEXT-small-EN.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 47mm
Max. operating current: 0.1A
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4C-1342 OMRON Category: Limit Switches
Description: Limit switch; SPDT; cables; 5m; IP67; No.of mount.holes: 2; metal
Manufacturer series: D4C
Body material: metal
Operating temperature: -10...70°C
Mounting holes pitch: 25mm
Type of sensor: limit switch
Number of mounting holes: 2
DC contacts rating @R: 4A / 30V DC
Lead length: 5m
AC contacts rating @R: 5A / 250V AC
Connection: cables
IP rating: IP67
Resistance to: oils
Output configuration: SPDT
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 360P/R 1M E6C3-CWZ3XH 360P/R 1M OMRON e6c3-c_ds_e_7_3_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 360P/R 2M E6C3-CWZ3XH 360P/R 2M OMRON e6c3-c_ds_e_7_3_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH-3600 2M E6C3-CWZ3XH-3600 2M OMRON e6c3-c.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Switching frequency max: 125kHz
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 3600P/R 1M E6C3-CWZ3XH 3600P/R 1M OMRON e6c3-c_ds_e_7_3_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4N-4ARE OMRON c130d4nminiaturesafetylimitswitchdatasheeten.pdf Category: Limit Switches
Description: Limit switch; roller lever; 10A; max.240VAC; max.250VDC; M20; IP67
Operating temperature: -30...70°C
Type of sensor: limit switch
Connection: M20
Body material: plastic
Kind of actuator: roller lever
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
IP rating: IP67
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 200P/R 1M E6C3-CWZ3XH 200P/R 1M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 200P/R 2M E6C3-CWZ3XH 200P/R 2M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 2048P/R 1M E6C3-CWZ3XH 2048P/R 1M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 2048P/R 2M E6C3-CWZ3XH 2048P/R 2M OMRON e6c3-c_ds_e_7_2_csm495.pdf Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A4015 3G3M1-A4015 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 1.5/2.2kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+1007.34 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A4022 3G3M1-A4022 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+1125.86 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A4040 3G3M1-A4040 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 4/5.5kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 4/5.5kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+1371.57 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A2007 3G3M1-A2007 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.75/1.1kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.75/1.1kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+906.21 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A2004 3G3M1-A2004 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.4/0.75kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.4/0.75kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+742.1 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A2022 3G3M1-A2022 OMRON 3G3M1-series.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+1156.25 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3MX2-A4015-EV2 3G3MX2-A4015-EV2 OMRON mx2-ev2-EN.pdf Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x380÷480VAC
Manufacturer series: 3G3MX2
IP rating: IP20
Operating temperature: -10...50°C
The programming method: keypad; operator panel; PC
Electrical connection: screw terminals
Type of automation module: vector inverter
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
Number of analog inputs: 3
Voltage between phases (for three phase system): 3 x 380...480V AC
Number of inputs: 10
Max motor power: 1.5/2.2kW
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+1351.34 EUR
Im Einkaufswagen  Stück im Wert von  UAH
K8DS-PZ2 K8DS-PZ2 OMRON K8DS-PZ.pdf Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PZ; SPDT
Manufacturer series: K8DS-PZ
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: overvoltage; phase asymmetry; phase failure; phase sequence; undervoltage
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
1+208.46 EUR
Im Einkaufswagen  Stück im Wert von  UAH
K8DS-PA2 K8DS-PA2 OMRON K8DS-PA.pdf Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PA; SPDT
Manufacturer series: K8DS-PA
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: phase asymmetry; phase failure; phase sequence
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
1+153.95 EUR
Im Einkaufswagen  Stück im Wert von  UAH
S8VK-T48024 S8VK-T48024 OMRON S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 480W; 24VDC; 20A; OUT: 1
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 150x125x95mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 20A
Output voltage: 24V DC
Efficiency: 91%
Supply voltage: 450...600V DC
Power: 480W
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+529.03 EUR
Im Einkaufswagen  Stück im Wert von  UAH
S8VK-T12024 S8VK-T12024 OMRON S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 120W; 24VDC; 5A; 450÷600VDC
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 122.2x104.6x40mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 5A
Output voltage: 24V DC
Efficiency: 89%
Supply voltage: 450...600V DC
Power: 0.12kW
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
auf Bestellung 9 Stücke:
Lieferzeit 14-21 Tag (e)
1+286.6 EUR
5+275.27 EUR
Im Einkaufswagen  Stück im Wert von  UAH
XS2F-M12PVC4A5M XS2F-M12PVC4A5M OMRON XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M12 female; angled; Len: 5m
Connector: plug
Number of pins: 4
Max. operating voltage: 125V DC
Type of connection cable: for sensors/automation
IP rating: IP67
Wire insulation material: PVC
Operating temperature: -10...80°C
Cable external diameter: 5mm
Max. operating current: 4A
Cable length: 5m
Polarisation: A code - DeviceNet / CANopen
Connector variant: angled
Cable/adapter structure: M12 female
Manufacturer series: XS2
Insulation colour: black
auf Bestellung 44 Stücke:
Lieferzeit 14-21 Tag (e)
4+28.01 EUR
5+25.61 EUR
10+25.2 EUR
Mindestbestellmenge: 4 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2V-X4B1-M1 E2V-X4B1-M1 OMRON e2v_en.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 100mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 40Hz
Overall length: 60mm
Number of pins: 3
Plating material: nickel
auf Bestellung 8 Stücke:
Lieferzeit 14-21 Tag (e)
1+220.71 EUR
5+206.3 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS15-WP-C1 2M E2B-M30KS15-WP-C1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Plating material: nickel
auf Bestellung 8 Stücke:
Lieferzeit 14-21 Tag (e)
2+50.34 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS10-WP-B1 2M E2B-M30KS10-WP-B1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 400Hz
Connection: cables
Output configuration: PNP / NO
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...10mm
Type of sensor: inductive
auf Bestellung 4 Stücke:
Lieferzeit 14-21 Tag (e)
2+50.46 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X15B1T30 5M E2E-X15B1T30 5M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷15mm; 10÷30VDC; M30; 5m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 5m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
1+91.73 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS10-WP-C1 2M E2B-M30KS10-WP-C1 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
auf Bestellung 4 Stücke:
Lieferzeit 14-21 Tag (e)
2+52.75 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X15B230 2M E2E-X15B230 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Manufacturer series: E2E Next
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
Trade name: E2E Next
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
1+85.43 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS15-WP-B2 2M E2B-M30KS15-WP-B2 2M OMRON e2b_d116-e1_1_5_csm1012652.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
auf Bestellung 4 Stücke:
Lieferzeit 14-21 Tag (e)
2+56.03 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X22B1T30 2M E2E-X22B1T30 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+118.18 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X22C130 2M E2E-X22C130 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Plating material: nickel
Manufacturer series: E2E Next
Trade name: E2E Next
Lead length: 2m
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+116.38 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X22B230 2M E2E-X22B230 2M OMRON E2E-NEXT-small-EN.pdf E2A-replacement.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NC
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Trade name: E2E Next
Plating material: nickel
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
1+111.46 EUR
Im Einkaufswagen  Stück im Wert von  UAH
NX701-1700 NX701-1700 OMRON Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
NX701-Z700 NX701-Z700 OMRON Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E2A-M12KS04-M1-B1 E2A-M12KS04-M1-B1 OMRON E2A-replacement.pdf e2a.pdf Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 200mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -40...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 1kHz
Overall length: 48mm
Plating material: nickel
Number of pins: 4
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G2RL-1A-E-CV-HA-DC12 OMRON Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 12VDC; Icontacts max: 16A; G2RL
Type of relay: electromagnetic
Coil voltage: 12V DC
Contact current max.: 16A
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 360Ω
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 33.3mA
Operate time: 15ms
Switched voltage: max. 440V AC
Release time: 5ms
Current rating: 16A
Relay variant: monostable; power
Operating temperature: -40...85°C
Leads: for PCB
auf Bestellung 28 Stücke:
Lieferzeit 14-21 Tag (e)
20+6.76 EUR
Mindestbestellmenge: 20 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E3AS-HL500MT M3 E3AS-HL500MT M3 OMRON E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+560.13 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E3AS-HL500LMT M3 E3AS-HL500LMT M3 OMRON E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
1+569.36 EUR
Im Einkaufswagen  Stück im Wert von  UAH
M2DT-500GY OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; green; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: green
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
M2DT-500R OMRON PushbuttonSwitches_brochure_en_200704.pdf Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; red; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: red
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-AG5B 256P/R 1M e6c3-a_ds_e_8_1_csm494.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: absolute; Usup: 12÷24VDC; 256imp/revol; OUT: PNP; IP65
Operating temperature: -10...70°C
IP rating: IP65
Output configuration: PNP
Sensors features: shaft 8mm
Body dimensions: Ø50x58mm
Lead length: 1m
Supply voltage: 12...24V DC
Resolution: 256imp/revol.
Type of encoder: absolute
Connection: cables
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-AG5B 256P/R 2M e6c3-a_ds_e_8_1_csm494.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: absolute; Usup: 12÷24VDC; 256imp/revol; OUT: PNP; IP65
Operating temperature: -10...70°C
IP rating: IP65
Output configuration: PNP
Sensors features: shaft 8mm
Body dimensions: Ø50x58mm
Lead length: 2m
Supply voltage: 12...24V DC
Resolution: 256imp/revol.
Type of encoder: absolute
Connection: cables
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
AX-RC00252981-DE
Hersteller: OMRON
Category: Three Phase Inverters
Description: DC link reactor; 298.1A; 0.25mH
Type of control accessories: DC link reactor
Current rating: 298.1A
Inductance: 0.25mH
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G3NA-490B-UTU-2 5-24VDC
Hersteller: OMRON
Category: One Phase Solid State Relays
Description: Relay: solid state; 90A; 1-phase
Type of relay: solid state
Relay variant: 1-phase
Max. operating current: 90A
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G3NA-490B-UTU-2 100-240VAC
Hersteller: OMRON
Category: One Phase Solid State Relays
Description: Relay: solid state; 90A; 1-phase
Type of relay: solid state
Max. operating current: 90A
Relay variant: 1-phase
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
XS4W-D521-105-D
Hersteller: OMRON
Category: I/O Systems and Modules
Description: Connection cable; IP67; 5m; Type: straight; PIN: 5; DRT2
Type of control accessories: connection cable
IP rating: IP67
Cable length: 5m
Connector variant: straight
Number of pins: 5
Application - series/manufacturer: DRT2
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
A22NS-3BM-NBA-G121-NN
Hersteller: OMRON
Category: Panel Mount Switches, Standard 22mm
Description: Switch: rotary; 22mm; Stabl.pos: 3; NC + NO x2; black; none; IP66
Manufacturer series: A22NS
Type of switch: rotary
Illumination: none
Operating temperature: -25...70°C
Switch standard: 22mm
Mounting hole dimensions: Ø22.3mm
Stable positions number: 3
Number of positions: 3
Contacts configuration: NC + NO x2
IP rating: IP66
Leads: screw terminals
Actuator colour: black
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
XS3F-M8PVC4S5M XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf
Hersteller: OMRON
Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M8 female; straight; Len: 5m
Type of connection cable: for sensors/automation
Number of pins: 4
Cable/adapter structure: M8 female
Connector variant: straight
Cable length: 5m
Connector: plug
Max. operating voltage: 125V DC
Max. operating current: 1A
Manufacturer series: XS3
Wire insulation material: PVC
IP rating: IP67
Insulation colour: black
Cable external diameter: 5mm
Polarisation: A code - DeviceNet / CANopen
Operating temperature: -10...80°C
auf Bestellung 14 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
4+28.1 EUR
10+23.82 EUR
Mindestbestellmenge: 4 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D2SP0242C
Hersteller: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
auf Bestellung 131 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
53+2.49 EUR
Mindestbestellmenge: 53 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D2SP0246F
Hersteller: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
auf Bestellung 148 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
24+5.41 EUR
120+4.87 EUR
Mindestbestellmenge: 24 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D2SP0256C
Hersteller: OMRON
Category: Microswitches SNAP ACTION
Description: Microswitch SNAP ACTION
Type of switch: microswitch SNAP ACTION
auf Bestellung 140 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
24+5.47 EUR
120+4.94 EUR
Mindestbestellmenge: 24 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
D4BS-45FS c094_d4bs_safety-door_switch_datasheet_en.pdf
Hersteller: OMRON
Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4BS-25FS c094_d4bs_safety-door_switch_datasheet_en.pdf
Hersteller: OMRON
Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC + NO; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: G1/2
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC + NO
Safety switches features: no key
Switches features: slow action contacts
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4BS-4AFS C094-E2-04A-X%2BD4BS%2BDatasheet.pdf
Hersteller: OMRON
Category: Standard Safety Switches
Description: Safety switch: key operated; D4BS; NC x2; Features: no key; IP67
Manufacturer series: D4BS
Body material: metal
Operating temperature: -40...80°C
Dimensions: 40x43x111.5mm
Number of key entry slots: 4
Contacts electrical parameters: 400V AC / 2A
Mechanical durability: 1000000 cycles
Related items: D4BS-K1; D4BS-K2; D4BS-K3
Electrical connection: M20
Type of safety switch: key operated
IP rating: IP67
Contacts configuration: NC x2
Safety switches features: no key
Switches features: slow action contacts
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D40ML-SS2-B-ACT
Hersteller: OMRON
Category: Standard Safety Switches
Description: Actuator; IP67; stainless steel; -25÷40°C; 600N; D40ML
Force: 600N
Application - series/manufacturer: D40ML
IP rating: IP67
Operating temperature: -25...40°C
Type of sensors accessories: actuator
Body material: stainless steel
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
FQ2-S30010F-08 fq2_q193-e1_14_6_csm1006918.pdf?id=3131
Hersteller: OMRON
Category: Measurement Sensors
Description: Sensor: vision; 57mm; NPN; FQ2-S3; Resolution: 760000px
Type of sensor: vision
Range: 57mm
Output configuration: NPN
Manufacturer series: FQ2-S3
Resolution: 760000px
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G3NA-250B-UTU 5-24VDC
Hersteller: OMRON
Category: One Phase Solid State Relays
Description: Relay: solid state; Ucntrl: 5÷24VDC; 50A; 24÷240VAC; G3NA; 1-phase
Manufacturer series: G3NA
Body dimensions: 58x43x27mm
Type of relay: solid state
Operating temperature: -30...80°C
Max. operating current: 50A
Switched voltage: 24...240V AC
Control voltage: 5...24V DC
Relay variant: 1-phase
Related items: R99-12
Switching method: zero voltage switching
Caution!: Maximal load current with use of suitable heatsink
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+149.67 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X8MC312-M1 E2A-replacement.pdf E2E-NEXT-small-EN.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; IP67
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 48mm
Max. operating current: 0.1A
Number of pins: 4
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: M12 male
Manufacturer series: E2E Next
Trade name: E2E Next
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X5MC312 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷5mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...5mm
Overall length: 47mm
Max. operating current: 200mA
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X8MC312 2M E2A-replacement.pdf E2E-NEXT-small-EN.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO + NC; 0÷8mm; 10÷30VDC; M12; 2m
Type of sensor: inductive
IP rating: IP67
Switch housing: M12
Plating material: nickel
Kind of forehead: non-embedded
Output configuration: NPN / NO + NC
Operating temperature: -25...70°C
Range: 0...8mm
Overall length: 47mm
Max. operating current: 0.1A
Lead length: 2m
Supply voltage: 10...30V DC
Switching frequency max: 800Hz
Body material: brass
Connection: cables
Manufacturer series: E2E Next
Trade name: E2E Next
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4C-1342
Hersteller: OMRON
Category: Limit Switches
Description: Limit switch; SPDT; cables; 5m; IP67; No.of mount.holes: 2; metal
Manufacturer series: D4C
Body material: metal
Operating temperature: -10...70°C
Mounting holes pitch: 25mm
Type of sensor: limit switch
Number of mounting holes: 2
DC contacts rating @R: 4A / 30V DC
Lead length: 5m
AC contacts rating @R: 5A / 250V AC
Connection: cables
IP rating: IP67
Resistance to: oils
Output configuration: SPDT
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 360P/R 1M e6c3-c_ds_e_7_3_csm495.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 360P/R 2M e6c3-c_ds_e_7_3_csm495.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 360imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 360imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH-3600 2M e6c3-c.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 2m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Switching frequency max: 125kHz
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 3600P/R 1M e6c3-c_ds_e_7_3_csm495.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 3600imp/revol; OUT: linear
Type of encoder: incremental
Supply voltage: 5...12V DC
Resolution: 3600imp/revol.
Output configuration: linear
IP rating: IP65
Connection: cables
Lead length: 1m
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Sensors features: shaft 8mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
D4N-4ARE c130d4nminiaturesafetylimitswitchdatasheeten.pdf
Hersteller: OMRON
Category: Limit Switches
Description: Limit switch; roller lever; 10A; max.240VAC; max.250VDC; M20; IP67
Operating temperature: -30...70°C
Type of sensor: limit switch
Connection: M20
Body material: plastic
Kind of actuator: roller lever
Mounting holes pitch: 20...22mm
DC contacts rating @R: 0.55A / 125V DC
Number of mounting holes: 2
AC contacts rating @R: 3A / 240V AC
Contact current max.: 10A
Switched voltage: max. 240V AC; max. 250V DC
IP rating: IP67
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 200P/R 1M e6c3-c_ds_e_7_2_csm495.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 200P/R 2M e6c3-c_ds_e_7_2_csm495.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 200imp/revol; OUT: linear
Operating temperature: -10...70°C
Resolution: 200imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 2048P/R 1M e6c3-c_ds_e_7_2_csm495.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 1m
IP rating: IP65
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E6C3-CWZ3XH 2048P/R 2M e6c3-c_ds_e_7_2_csm495.pdf
Hersteller: OMRON
Category: Encoders
Description: Encoder: incremental; Usup: 5÷12VDC; 2048imp/revol; OUT: linear
Supply voltage: 5...12V DC
Body dimensions: Ø50x58mm
Operating temperature: -10...70°C
Resolution: 2048imp/revol.
Type of encoder: incremental
Connection: cables
Sensors features: shaft 8mm
Output configuration: linear
Lead length: 2m
IP rating: IP65
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A4015 3G3M1-series.pdf
Hersteller: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 1.5/2.2kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+1007.34 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A4022 3G3M1-series.pdf
Hersteller: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+1125.86 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A4040 3G3M1-series.pdf
Hersteller: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 4/5.5kW; 3x400VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 380...480V AC
Inverter output voltage: 3 x 400V AC
Max motor power: 4/5.5kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+1371.57 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A2007 3G3M1-series.pdf
Hersteller: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.75/1.1kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.75/1.1kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+906.21 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A2004 3G3M1-series.pdf
Hersteller: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 0.4/0.75kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 0.4/0.75kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+742.1 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3M1-A2022 3G3M1-series.pdf
Hersteller: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 2.2/3kW; 3x230VAC; 3G3M1
Manufacturer series: 3G3M1
The programming method: keypad; PC
Type of automation module: vector inverter
Voltage between phases (for three phase system): 3 x 200...240V AC
Inverter output voltage: 3 x 230V AC
Max motor power: 2.2/3kW
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+1156.25 EUR
Im Einkaufswagen  Stück im Wert von  UAH
3G3MX2-A4015-EV2 mx2-ev2-EN.pdf
Hersteller: OMRON
Category: Three Phase Inverters
Description: Automation module: vector inverter; 1.5/2.2kW; 3x380÷480VAC
Manufacturer series: 3G3MX2
IP rating: IP20
Operating temperature: -10...50°C
The programming method: keypad; operator panel; PC
Electrical connection: screw terminals
Type of automation module: vector inverter
Output frequency: 0.1...400Hz
Starting/stopping time: 0.01...3600/0.01...3600s
Number of analog outputs: 2
Number of analog inputs: 3
Voltage between phases (for three phase system): 3 x 380...480V AC
Number of inputs: 10
Max motor power: 1.5/2.2kW
Protection: anti-overload OPP; anti-overvoltage OVP; overheating OTP; short circuit protection SCP; voltage drop BOP
Mounting: for wall mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+1351.34 EUR
Im Einkaufswagen  Stück im Wert von  UAH
K8DS-PZ2 K8DS-PZ.pdf
Hersteller: OMRON
Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PZ; SPDT
Manufacturer series: K8DS-PZ
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: overvoltage; phase asymmetry; phase failure; phase sequence; undervoltage
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+208.46 EUR
Im Einkaufswagen  Stück im Wert von  UAH
K8DS-PA2 K8DS-PA.pdf
Hersteller: OMRON
Category: Monitoring Relays
Description: Voltage monitoring relay; for DIN rail mounting; K8DS-PA; SPDT
Manufacturer series: K8DS-PA
IP rating: IP20
Operating temperature: -20...60°C
Controlled parameter: phase asymmetry; phase failure; phase sequence
Leads: screw terminals
Type of automation module: voltage monitoring relay
Body dimensions: 17.5x80x74mm
Contact actuation delay: 0.1...30s
Voltage between phases (for three phase system): 3 x 380...480V AC
Controlled parameter range: 3x 380V AC...480V AC
Output 1 electrical parameters: 24V DC / 5A; 250V AC / 5A
Kind of output 1: SPDT
Mounting: for DIN rail mounting
Power supply: from tested wiring system
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+153.95 EUR
Im Einkaufswagen  Stück im Wert von  UAH
S8VK-T48024 S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf
Hersteller: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 480W; 24VDC; 20A; OUT: 1
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 150x125x95mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 20A
Output voltage: 24V DC
Efficiency: 91%
Supply voltage: 450...600V DC
Power: 480W
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+529.03 EUR
Im Einkaufswagen  Stück im Wert von  UAH
S8VK-T12024 S8VK-T.pdf s8vk.pdf S8VK-CATALOGUE.pdf
Hersteller: OMRON
Category: Din Rail Mounting Power Supplies
Description: Power supply: switching; for DIN rail; 120W; 24VDC; 5A; 450÷600VDC
Manufacturer series: S8VK-T
Operating temperature: -40...70°C
Additional functions: parallel function
Caution!: rated parameters obtained at full load
Electrical connection: terminal block
Type of power supply: switching
Body dimensions: 122.2x104.6x40mm
Number of outputs: 1
Voltage between phases (for three phase system): 3 x 380...480V AC
Output current: 5A
Output voltage: 24V DC
Efficiency: 89%
Supply voltage: 450...600V DC
Power: 0.12kW
Protection: anti-overload OPP; anti-overvoltage OVP; short circuit protection SCP
Kind of power supply: for DIN rail
Mounting: for DIN rail mounting
auf Bestellung 9 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+286.6 EUR
5+275.27 EUR
Im Einkaufswagen  Stück im Wert von  UAH
XS2F-M12PVC4A5M XS2F,XS3F,XS5F,W,C,Y92E,XW3D_EN.pdf
Hersteller: OMRON
Category: Sensors - Cables
Description: Cable: for sensors/automation; PIN: 4; M12 female; angled; Len: 5m
Connector: plug
Number of pins: 4
Max. operating voltage: 125V DC
Type of connection cable: for sensors/automation
IP rating: IP67
Wire insulation material: PVC
Operating temperature: -10...80°C
Cable external diameter: 5mm
Max. operating current: 4A
Cable length: 5m
Polarisation: A code - DeviceNet / CANopen
Connector variant: angled
Cable/adapter structure: M12 female
Manufacturer series: XS2
Insulation colour: black
auf Bestellung 44 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
4+28.01 EUR
5+25.61 EUR
10+25.2 EUR
Mindestbestellmenge: 4 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2V-X4B1-M1 e2v_en.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 100mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 40Hz
Overall length: 60mm
Number of pins: 3
Plating material: nickel
auf Bestellung 8 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+220.71 EUR
5+206.3 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS15-WP-C1 2M e2b_d116-e1_1_5_csm1012652.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Plating material: nickel
auf Bestellung 8 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
2+50.34 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS10-WP-B1 2M e2b_d116-e1_1_5_csm1012652.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 400Hz
Connection: cables
Output configuration: PNP / NO
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...10mm
Type of sensor: inductive
auf Bestellung 4 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
2+50.46 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X15B1T30 5M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷15mm; 10÷30VDC; M30; 5m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...15mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 5m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 250Hz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+91.73 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS10-WP-C1 2M e2b_d116-e1_1_5_csm1012652.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷10mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...10mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 400Hz
Overall length: 60mm
Plating material: nickel
auf Bestellung 4 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
2+52.75 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X15B230 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Manufacturer series: E2E Next
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
Trade name: E2E Next
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+85.43 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2B-M30KS15-WP-B2 2M e2b_d116-e1_1_5_csm1012652.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷15mm; 10÷30VDC; M30; 2m; IP67
Supply voltage: 10...30V DC
Kind of forehead: embedded
Switch housing: M30
Plating material: nickel
Operating temperature: -25...70°C
Overall length: 60mm
Body material: brass
Switching frequency max: 250Hz
Connection: cables
Output configuration: PNP / NC
Max. operating current: 200mA
Lead length: 2m
IP rating: IP67
Range: 0...15mm
Type of sensor: inductive
auf Bestellung 4 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
2+56.03 EUR
Mindestbestellmenge: 2 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X22B1T30 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Additional functions: IO-Link (COM3)
Trade name: E2E Next
Plating material: nickel
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+118.18 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X22C130 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: NPN / NO; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: NPN / NO
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Plating material: nickel
Manufacturer series: E2E Next
Trade name: E2E Next
Lead length: 2m
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+116.38 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E2E-X22B230 2M E2E-NEXT-small-EN.pdf E2A-replacement.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NC; 0÷22mm; 10÷30VDC; M30; 2m; IP67
Type of sensor: inductive
Output configuration: PNP / NC
Range: 0...22mm
Supply voltage: 10...30V DC
Switch housing: M30
Connection: cables
Lead length: 2m
IP rating: IP67
Max. operating current: 0.1A
Operating temperature: -25...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 0.2kHz
Overall length: 60mm
Manufacturer series: E2E Next
Trade name: E2E Next
Plating material: nickel
auf Bestellung 2 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+111.46 EUR
Im Einkaufswagen  Stück im Wert von  UAH
NX701-1700
Hersteller: OMRON
Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
NX701-Z700
Hersteller: OMRON
Category: PLC Drivers
Description: Automation module: CPU unit; NX7; Interface: USB; 80MB; 40W
Interface: USB
Modules features: 256 axes
Communictions protocol: EtherCAT master; EtherNET/IP; EtherNET TCP/IP
Type of automation module: CPU unit
Manufacturer series: NX7
Power consumption: 40W
Memory capacity: 80MB
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
E2A-M12KS04-M1-B1 E2A-replacement.pdf e2a.pdf
Hersteller: OMRON
Category: DC Cylindrical Inductive Sensors
Description: Sensor: inductive; OUT: PNP / NO; 0÷4mm; 12÷24VDC; M12; IP67; 200mA
Type of sensor: inductive
Output configuration: PNP / NO
Range: 0...4mm
Supply voltage: 12...24V DC
Switch housing: M12
Connection: M12 male
IP rating: IP67
Max. operating current: 200mA
Operating temperature: -40...70°C
Kind of forehead: embedded
Body material: brass
Switching frequency max: 1kHz
Overall length: 48mm
Plating material: nickel
Number of pins: 4
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
G2RL-1A-E-CV-HA-DC12
Hersteller: OMRON
Category: Miniature Electromagnetic Relays
Description: Relay: electromagnetic; Ucoil: 12VDC; Icontacts max: 16A; G2RL
Type of relay: electromagnetic
Coil voltage: 12V DC
Contact current max.: 16A
Manufacturer series: G2RL
Mounting: THT
Coil resistance: 360Ω
Body dimensions: 29x12.7x15.7mm
Contact material: silver alloy
Coil current: 33.3mA
Operate time: 15ms
Switched voltage: max. 440V AC
Release time: 5ms
Current rating: 16A
Relay variant: monostable; power
Operating temperature: -40...85°C
Leads: for PCB
auf Bestellung 28 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
20+6.76 EUR
Mindestbestellmenge: 20 Stücke
Im Einkaufswagen  Stück im Wert von  UAH
E3AS-HL500MT M3 E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf
Hersteller: OMRON
Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+560.13 EUR
Im Einkaufswagen  Stück im Wert von  UAH
E3AS-HL500LMT M3 E3AS-HL-Series-CMOS-Photoelectric-Sensor-Datasheet.pdf
Hersteller: OMRON
Category: Standard Photoelectric Sensors
Description: Sensor: photoelectric; Range: 35÷500mm; PNP; DARK-ON,LIGHT-ON
Type of sensor: photoelectric
Output configuration: PNP
Connection: M8 male
IP rating: IP67
Operating temperature: -10...50°C
Body material: stainless steel
Range: 35...500mm
Supply voltage: 10...30V DC
Operation modes: DARK-ON; LIGHT-ON
Operation mode: diffuse-reflective
auf Bestellung 1 Stücke:
Lieferzeit 14-21 Tag (e)
AnzahlPrivatkunde
1+569.36 EUR
Im Einkaufswagen  Stück im Wert von  UAH
M2DT-500GY PushbuttonSwitches_brochure_en_200704.pdf
Hersteller: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; green; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: green
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
M2DT-500R PushbuttonSwitches_brochure_en_200704.pdf
Hersteller: OMRON
Category: Panel Mount Accessories
Description: Control lamp; M2D; Ø8mm; red; Face dim: Ø9mm; -10÷55°C
Type of light indictaor: control lamp
Manufacturer series: M2D
Mounting hole dimensions: Ø8mm
Lamp colour: red
Face dimensions: Ø9mm
Caution!: Illuminating unit has to be ordered separately
Operating temperature: -10...55°C
Produkt ist nicht verfügbar
Im Einkaufswagen  Stück im Wert von  UAH
Wählen Sie Seite:    << Vorherige Seite ]  1 44 88 132 176 220 264 308 352 396 405 406 407 408 409 410 411 412 413 414 415 440 449  Nächste Seite >> ]